PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009779274.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 539aa    MW: 62179.9 Da    PI: 5.2325
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009779274.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS294.42.9e-901505241374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetsekn.sseelaalklfsevsPilkf 93 
                     lve Ll cAe v +++  +a +lL++  + +s++g+p+qRl+ yf +AL++r+ +  +++  k l+    ++ +   ++++  ++ ++  P+ ++
  XP_009779274.1 150 LVECLLFCAEKVWQKQYDRAINLLNECDKFSSKTGNPVQRLVYYFSRALRERVDKeIGKNSTKGLEIYGMQDLEnALRSINQCTIAVQDMPLCQV 244
                     57889*************************************************97778888888777666544377777777889999****** PP

            GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egpp..slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                       ++  qaI+e v +++++HiiD++i++G+QW  L+qaL + +  +++p   l+iT++g+ +  s+++leetg+rL +fAe+l++ f f+ ++ +
  XP_009779274.1 245 IKFVGIQAIVENVRNSKKIHIIDLEIKMGVQWTILIQALVTHQqeSQSPfeYLKITAIGNTQ--SRTKLEETGKRLMSFAESLNLLFYFKSVIIE 337
                     ****************************************887664455458********55..******************************* PP

            GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                     ++ dl+ ++L+++p+E++aV  ++ l ++  ++ +     d ++ ++k+++ +++v++e ea+hns+ F++rf+eal y+ a+fd +e  + +++
  XP_009779274.1 338 DIMDLKKNDLDIDPEETIAVYAQHFLANMIMQQEK----LDFLMGFIKGINQRIMVIAEVEANHNSPVFVNRFIEALFYHGAFFDLFEDCMKNNE 428
                     *****************************955555....555***************************************************** PP

            GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
                     ++r+++E e++ + i+n+va+eg+er+ rh t e Wre ++++G+++++ls++   qak+ll+k++  + +++e + + lv+gWk+ pL ++SaW
  XP_009779274.1 429 SNRTTMESEFMWQGIRNIVAAEGEERTIRHVTIELWREYFKRFGMEEMKLSNSSSYQAKMLLEKFStRNSFTLEMNGNFLVIGWKETPLNTLSAW 523
                     ******************************************************************9999************************* PP

            GRAS 374 r 374
                     +
  XP_009779274.1 524 K 524
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.857124503IPR005202Transcription factor GRAS
PfamPF035141.0E-87150524IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MEPAQEISWF STGIVLNQED EQDITSKKLL PSDSDFDTVD DWDFDVENET KNHLYVTPES  60
LIHNKKSRTS SISSLNILKD FGNGFRKLKG QKITIQTSEI ECANNGKLST DSILRLGGQN  120
FIQSFESSVD HPFVSSLLSI SEEDSRSVEL VECLLFCAEK VWQKQYDRAI NLLNECDKFS  180
SKTGNPVQRL VYYFSRALRE RVDKEIGKNS TKGLEIYGMQ DLENALRSIN QCTIAVQDMP  240
LCQVIKFVGI QAIVENVRNS KKIHIIDLEI KMGVQWTILI QALVTHQQES QSPFEYLKIT  300
AIGNTQSRTK LEETGKRLMS FAESLNLLFY FKSVIIEDIM DLKKNDLDID PEETIAVYAQ  360
HFLANMIMQQ EKLDFLMGFI KGINQRIMVI AEVEANHNSP VFVNRFIEAL FYHGAFFDLF  420
EDCMKNNESN RTTMESEFMW QGIRNIVAAE GEERTIRHVT IELWREYFKR FGMEEMKLSN  480
SSSYQAKMLL EKFSTRNSFT LEMNGNFLVI GWKETPLNTL SAWKFRKRSI SHGACFFTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-381475241375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779274.10.0PREDICTED: scarecrow-like protein 18
RefseqXP_016450775.10.0PREDICTED: scarecrow-like protein 18
TrEMBLM1A0F90.0M1A0F9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000119540.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34272149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.16e-56RGA-like 1